Lineage for d1wipa2 (1wip A:179-291)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220286Protein N-terminal domain of CD4 [48737] (2 species)
  7. 220287Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
  8. 220303Domain d1wipa2: 1wip A:179-291 [19733]
    Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4

Details for d1wipa2

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form

SCOP Domain Sequences for d1wipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipa2 b.1.1.1 (A:179-291) N-terminal domain of CD4 {Human (Homo sapiens)}
fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv
krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv

SCOP Domain Coordinates for d1wipa2:

Click to download the PDB-style file with coordinates for d1wipa2.
(The format of our PDB-style files is described here.)

Timeline for d1wipa2: