SCOPe 2.07: Domain d4e91a_: 4e91 A:

Lineage for d4e91a_ (4e91 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d4e91a_: 4e91 A: [197294]
   automated match to d1afva_
   complexed with 0oe, 0of, iod

Details for d4e91a_

PDB Entry: 4e91, 1.7 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BD3

PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4e91a_:

Sequence, based on SEQRES records:

>d4e91a_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records):

>d4e91a_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaam
qmlketineeaaewdrlhpvmreprgsdiagttstlqeqigwmthnppipvgeiykrwii
lglnkivrmys

Timeline for d4e91a_:

• d4e91a_ first appeared in SCOPe 2.02
  
• d4e91a_ appears in SCOPe 2.06
  
• d4e91a_ appears in the current release, SCOPe 2.08