Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) |
Family d.35.1.0: automated matches [196913] (1 protein) not a true family |
Protein automated matches [196914] (3 species) not a true protein |
Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries) |
Domain d4jetc_: 4jet C: [197195] automated match to d1dkha_ complexed with cl, hem |
PDB Entry: 4jet (more details), 2.2 Å
SCOPe Domain Sequences for d4jetc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jetc_ d.35.1.0 (C:) automated matches {Yersinia pestis [TaxId: 632]} sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd
Timeline for d4jetc_: