Lineage for d4jetj_ (4jet J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550221Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2550222Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2550240Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 2550241Protein automated matches [196914] (3 species)
    not a true protein
  7. 2550246Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries)
  8. 2550259Domain d4jetj_: 4jet J: [202746]
    automated match to d4jeta_
    complexed with cl, hem

Details for d4jetj_

PDB Entry: 4jet (more details), 2.2 Å

PDB Description: 2.2a resolution structure of holo hemophore hasa from yersinia pestis
PDB Compounds: (J:) hemophore hasa

SCOPe Domain Sequences for d4jetj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jetj_ d.35.1.0 (J:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd

SCOPe Domain Coordinates for d4jetj_:

Click to download the PDB-style file with coordinates for d4jetj_.
(The format of our PDB-style files is described here.)

Timeline for d4jetj_: