Lineage for d4g2jb1 (4g2j B:182-505)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737039Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 2737043Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
    Uniprot O76083 241-566
  8. 2737055Domain d4g2jb1: 4g2j B:182-505 [197159]
    Other proteins in same PDB: d4g2ja2, d4g2jb2
    automated match to d3dy8a_
    complexed with 0wf, mg, zn

Details for d4g2jb1

PDB Entry: 4g2j (more details), 2.4 Å

PDB Description: Human pde9 in complex with selective compound
PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4g2jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2jb1 a.211.1.2 (B:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

SCOPe Domain Coordinates for d4g2jb1:

Click to download the PDB-style file with coordinates for d4g2jb1.
(The format of our PDB-style files is described here.)

Timeline for d4g2jb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g2jb2