SCOP 1.61: Domain d1d4cc1: 1d4c C:3-102

Lineage for d1d4cc1 (1d4c C:3-102)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)

5. Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries)

8. Domain d1d4cc1: 1d4c C:3-102 [19700]
   Other proteins in same PDB: d1d4ca2, d1d4ca3, d1d4cb2, d1d4cb3, d1d4cc2, d1d4cc3, d1d4cd2, d1d4cd3

Details for d1d4cc1

PDB Entry: 1d4c, 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1

SCOP Domain Sequences for d1d4cc1:

Sequence; same for both SEQRES and ATOM records:

>d1d4cc1 a.138.1.3 (C:3-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens}
evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphks
hligeiactschkgheksvaycdachsfgfdmpfggkwer

Timeline for d1d4cc1:

• d1d4cc1 first appeared (with stable ids) in SCOP 1.55
  
• d1d4cc1 appears in SCOP 1.59
  
• d1d4cc1 appears in SCOP 1.63
  
• d1d4cc1 appears in the current release, SCOPe 2.08