Lineage for d4k3fa_ (4k3f A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1392004Species Pseudomonas aeruginosa [TaxId:208964] [196922] (1 PDB entry)
  8. 1392005Domain d4k3fa_: 4k3f A: [196923]
    automated match to d1xs5a_
    complexed with cl, gol, mse, so4

Details for d4k3fa_

PDB Entry: 4k3f (more details), 1.6 Å

PDB Description: crystal structure of a putative tonb-dependent receptor (pa5505) from pseudomonas aeruginosa pao1 at 1.60 a resolution
PDB Compounds: (A:) Probable TonB-dependent receptor

SCOPe Domain Sequences for d4k3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3fa_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gaesltvaatpvphaeilnvvkpllakegvdlkikeftdyvqpnvqvsekrldanffqhq
pyldefnkakgtdlvavtgvhieplgaysskykkldelpsgatvvipndatnggrallll
dkagviklkdnksitatpkdivdnpknikireleaatlprvltqvdmalintnyaleakl
nptkdalaiegsdspyvnilvarpdnkdsdamqklakalhsaeikqfiqekykgavvpaf

SCOPe Domain Coordinates for d4k3fa_:

Click to download the PDB-style file with coordinates for d4k3fa_.
(The format of our PDB-style files is described here.)

Timeline for d4k3fa_: