SCOPe 2.02: Domain d4k3fa_: 4k3f A:

Lineage for d4k3fa_ (4k3f A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (34 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [196922] (1 PDB entry)

8. Domain d4k3fa_: 4k3f A: [196923]
   automated match to d1xs5a_
   complexed with cl, gol, mse, so4

Details for d4k3fa_

PDB Entry: 4k3f, 1.6 Å

PDB Description: crystal structure of a putative tonb-dependent receptor (pa5505) from pseudomonas aeruginosa pao1 at 1.60 a resolution

PDB Compounds: (A:) Probable TonB-dependent receptor

SCOPe Domain Sequences for d4k3fa_:

Sequence; same for both SEQRES and ATOM records:

>d4k3fa_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gaesltvaatpvphaeilnvvkpllakegvdlkikeftdyvqpnvqvsekrldanffqhq
pyldefnkakgtdlvavtgvhieplgaysskykkldelpsgatvvipndatnggrallll
dkagviklkdnksitatpkdivdnpknikireleaatlprvltqvdmalintnyaleakl
nptkdalaiegsdspyvnilvarpdnkdsdamqklakalhsaeikqfiqekykgavvpaf

Timeline for d4k3fa_:

• d4k3fa_ is new in SCOPe 2.02-stable
  
• d4k3fa_ appears in SCOPe 2.03
  
• d4k3fa_ appears in the current release, SCOPe 2.08, called d4k3fa1