Lineage for d4h4fb_ (4h4f B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551816Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2551817Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2551818Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2551871Protein automated matches [190792] (4 species)
    not a true protein
  7. 2551886Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)
  8. 2551891Domain d4h4fb_: 4h4f B: [196898]
    automated match to d1egla_
    complexed with po4

Details for d4h4fb_

PDB Entry: 4h4f (more details), 1.9 Å

PDB Description: Crystal structure of human chymotrypsin C (CTRC) bound to inhibitor eglin c from Hirudo medicinalis
PDB Compounds: (B:) eglin c

SCOPe Domain Sequences for d4h4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h4fb_ d.40.1.1 (B:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

SCOPe Domain Coordinates for d4h4fb_:

Click to download the PDB-style file with coordinates for d4h4fb_.
(The format of our PDB-style files is described here.)

Timeline for d4h4fb_: