PDB entry 4h4f

View 4h4f on RCSB PDB site
Description: Crystal structure of human chymotrypsin C (CTRC) bound to inhibitor eglin c from Hirudo medicinalis
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, protease inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2012-09-17, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CLCR, CTRC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h4fb_
  • Chain 'Q':
    Compound: Chymotrypsin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CLCR, CTRC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h4fB (B:)
    msmgselksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgt
    nvvnhvphvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h4fB (B:)
    ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
    hvg
    

  • Chain 'Q':
    No sequence available.