Lineage for d3vqfa_ (3vqf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538962Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1538963Protein automated matches [190436] (5 species)
    not a true protein
  7. 1539107Species Mouse (Mus musculus) [TaxId:10090] [189959] (12 PDB entries)
  8. 1539108Domain d3vqfa_: 3vqf A: [196729]
    automated match to d2vwra_

Details for d3vqfa_

PDB Entry: 3vqf (more details), 1.2 Å

PDB Description: Crystal Structure Analysis of the PDZ Domain Derived from the Tight Junction Regulating Protein
PDB Compounds: (A:) E3 ubiquitin-protein ligase LNX

SCOPe Domain Sequences for d3vqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vqfa_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sfhvilnksspeeqlgiklvrrvdepgvfifnvlnggvadrhgqleendrvlainghdlr
fgspesaahliqaserrvhlvvsrq

SCOPe Domain Coordinates for d3vqfa_:

Click to download the PDB-style file with coordinates for d3vqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3vqfa_: