PDB entry 3vqf

View 3vqf on RCSB PDB site
Description: Crystal Structure Analysis of the PDZ Domain Derived from the Tight Junction Regulating Protein
Class: peptide binding protein
Keywords: PDZ domain, claudin C-terminus, PEPTIDE BINDING PROTEIN
Deposited on 2012-03-22, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.146
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase LNX
    Species: Mus musculus [TaxId:10090]
    Gene: Lnx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3vqfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3vqfA (A:)
gplgsdhddsfhvilnksspeeqlgiklvrrvdepgvfifnvlnggvadrhgqleendrv
lainghdlrfgspesaahliqaserrvhlvvsrq

    Sequence, based on observed residues (ATOM records): (download) 
    >3vqfA (A:)
sfhvilnksspeeqlgiklvrrvdepgvfifnvlnggvadrhgqleendrvlainghdlr
fgspesaahliqaserrvhlvvsrq