SCOPe 2.04: Domain d4hy7a_: 4hy7 A:

Lineage for d4hy7a_ (4hy7 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Wheat (Triticum aestivum) [TaxId:4565] [196725] (2 PDB entries)

8. Domain d4hy7a_: 4hy7 A: [196726]
   automated match to d1dywa_

Details for d4hy7a_

PDB Entry: 4hy7, 1.2 Å

PDB Description: Structural and biochemical characterization of a cytosolic wheat cyclophilin TaCypA-1

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4hy7a_:

Sequence; same for both SEQRES and ATOM records:

>d4hy7a_ b.62.1.1 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
anprvffdmtvggapagrivmelykdavprtvenfralctgekgvgksgkplhykgsafh
rvipdfmcqggdftrgngtggesiygekfadekfvhkhtkpgilsmanagpntngsqffi
ctvpcnwldgkhvvfgevvegmdvvkniekvgsrsgtcskqvviadcgql

Timeline for d4hy7a_:

• d4hy7a_ first appeared in SCOPe 2.02
  
• d4hy7a_ appears in SCOPe 2.03
  
• d4hy7a_ appears in SCOPe 2.05
  
• d4hy7a_ appears in the current release, SCOPe 2.08