| Class b: All beta proteins [48724] (174 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein automated matches [190077] (16 species) not a true protein |
| Species Wheat (Triticum aestivum) [TaxId:4565] [196725] (1 PDB entry) |
| Domain d4hy7a_: 4hy7 A: [196726] automated match to d1dywa_ |
PDB Entry: 4hy7 (more details), 1.2 Å
SCOPe Domain Sequences for d4hy7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hy7a_ b.62.1.1 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
anprvffdmtvggapagrivmelykdavprtvenfralctgekgvgksgkplhykgsafh
rvipdfmcqggdftrgngtggesiygekfadekfvhkhtkpgilsmanagpntngsqffi
ctvpcnwldgkhvvfgevvegmdvvkniekvgsrsgtcskqvviadcgql
Timeline for d4hy7a_: