Lineage for d4hy7a_ (4hy7 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325683Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1325684Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1325685Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1325926Protein automated matches [190077] (16 species)
    not a true protein
  7. 1325994Species Wheat (Triticum aestivum) [TaxId:4565] [196725] (1 PDB entry)
  8. 1325995Domain d4hy7a_: 4hy7 A: [196726]
    automated match to d1dywa_

Details for d4hy7a_

PDB Entry: 4hy7 (more details), 1.2 Å

PDB Description: Structural and biochemical characterization of a cytosolic wheat cyclophilin TaCypA-1
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4hy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hy7a_ b.62.1.1 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
anprvffdmtvggapagrivmelykdavprtvenfralctgekgvgksgkplhykgsafh
rvipdfmcqggdftrgngtggesiygekfadekfvhkhtkpgilsmanagpntngsqffi
ctvpcnwldgkhvvfgevvegmdvvkniekvgsrsgtcskqvviadcgql

SCOPe Domain Coordinates for d4hy7a_:

Click to download the PDB-style file with coordinates for d4hy7a_.
(The format of our PDB-style files is described here.)

Timeline for d4hy7a_: