SCOPe 2.07: Domain d4ijxb1: 4ijx B:3-147

Lineage for d4ijxb1 (4ijx B:3-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (27 PDB entries)

8. Domain d4ijxb1: 4ijx B:3-147 [196682]
   Other proteins in same PDB: d4ijxa2, d4ijxb2
   automated match to d1xsba_
   complexed with dpo, gol, mg, po4; mutant

Details for d4ijxb1

PDB Entry: 4ijx, 2.1 Å

PDB Description: Crystal structure of human Ap4A hydrolase E58A mutant complexed with DPO

PDB Compounds: (B:) Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

SCOPe Domain Sequences for d4ijxb1:

Sequence, based on SEQRES records:

>d4ijxb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqee
agieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleea
cqlaqfkemkaalqeghqflcsiea

Sequence, based on observed residues (ATOM records):

>d4ijxb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lracgliifrrclipknaieflllqasdgihhwtppkghvepgeddletalratqeeagi
eagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeacql
aqfkemkaalqeghqflcsiea

Timeline for d4ijxb1:

• d4ijxb1 first appeared in SCOPe 2.02, called d4ijxb_
  
• d4ijxb1 appears in SCOPe 2.06
  
• d4ijxb1 appears in the current release, SCOPe 2.08