| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47532] (5 PDB entries) |
| Domain d4f0zb_: 4f0z B: [196640] Other proteins in same PDB: d4f0za_ automated match to d1tcob_ complexed with ca, gol |
PDB Entry: 4f0z (more details), 1.7 Å
SCOPe Domain Sequences for d4f0zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0zb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
yplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdg
ngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkd
tqlqqivdktiinadkdgdgrisfeefcavvggld
Timeline for d4f0zb_: