Lineage for d4f0zb_ (4f0z B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710553Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)
  7. 2710556Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries)
  8. 2710557Domain d4f0zb_: 4f0z B: [196640]
    Other proteins in same PDB: d4f0za_
    automated match to d1tcob_
    complexed with ca, gol

Details for d4f0zb_

PDB Entry: 4f0z (more details), 1.7 Å

PDB Description: Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L
PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d4f0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0zb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
yplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdg
ngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkd
tqlqqivdktiinadkdgdgrisfeefcavvggld

SCOPe Domain Coordinates for d4f0zb_:

Click to download the PDB-style file with coordinates for d4f0zb_.
(The format of our PDB-style files is described here.)

Timeline for d4f0zb_: