SCOPe 2.02: Domain d4f0zb_: 4f0z B:

Lineage for d4f0zb_ (4f0z B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47532] (5 PDB entries)

8. Domain d4f0zb_: 4f0z B: [196640]
   Other proteins in same PDB: d4f0za_
   automated match to d1tcob_
   complexed with ca, gol

Details for d4f0zb_

PDB Entry: 4f0z, 1.7 Å

PDB Description: Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L

PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d4f0zb_:

Sequence; same for both SEQRES and ATOM records:

>d4f0zb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
yplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdg
ngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkd
tqlqqivdktiinadkdgdgrisfeefcavvggld

Timeline for d4f0zb_:

• d4f0zb_ is new in SCOPe 2.02-stable
  
• d4f0zb_ appears in SCOPe 2.03
  
• d4f0zb_ appears in the current release, SCOPe 2.08