Lineage for d1czja_ (1czj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734176Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2734177Species Desulfomicrobium norvegicum [TaxId:52561] [48702] (1 PDB entry)
    synonym: Desulfovibrio desulfuricans Norway
  8. 2734178Domain d1czja_: 1czj A: [19663]
    complexed with hem, so4

Details for d1czja_

PDB Entry: 1czj (more details), 2.16 Å

PDB Description: cytochrome c of class iii (ambler) 26 kd
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1czja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czja_ a.138.1.1 (A:) Cytochrome c3 {Desulfomicrobium norvegicum [TaxId: 52561]}
tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd
nikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq

SCOPe Domain Coordinates for d1czja_:

Click to download the PDB-style file with coordinates for d1czja_.
(The format of our PDB-style files is described here.)

Timeline for d1czja_: