SCOPe 2.08: Domain d1czja_: 1czj A:

Lineage for d1czja_ (1czj A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfomicrobium norvegicum [TaxId:52561] [48702] (1 PDB entry)
   synonym: Desulfovibrio desulfuricans Norway

8. Domain d1czja_: 1czj A: [19663]
   complexed with hem, so4

Details for d1czja_

PDB Entry: 1czj, 2.16 Å

PDB Description: cytochrome c of class iii (ambler) 26 kd

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1czja_:

Sequence; same for both SEQRES and ATOM records:

>d1czja_ a.138.1.1 (A:) Cytochrome c3 {Desulfomicrobium norvegicum [TaxId: 52561]}
tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd
nikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq

Timeline for d1czja_:

• d1czja_ first appeared (with stable ids) in SCOP 1.55, called d1czj__
  
• d1czja_ appears in SCOPe 2.07