![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
![]() | Species Desulfomicrobium norvegicum [TaxId:52561] [48702] (1 PDB entry) synonym: Desulfovibrio desulfuricans Norway |
![]() | Domain d1czja_: 1czj A: [19663] complexed with hem, so4 |
PDB Entry: 1czj (more details), 2.16 Å
SCOPe Domain Sequences for d1czja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czja_ a.138.1.1 (A:) Cytochrome c3 {Desulfomicrobium norvegicum [TaxId: 52561]} tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd nikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq
Timeline for d1czja_: