PDB entry 1czj

View 1czj on RCSB PDB site
Description: cytochrome c of class III (ambler) 26 kd
Class: electron transport
Keywords: octaheme cytochrome, electron transport
Deposited on 1996-01-12, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfomicrobium norvegicum [TaxId:52561]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1czja_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1czjA (A:)
    etfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegch
    dnikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1czjA (A:)
    tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd
    nikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq