Lineage for d3h5ia_ (3h5i A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356442Species Carboxydothermus hydrogenoformans [TaxId:246194] [196575] (1 PDB entry)
  8. 1356443Domain d3h5ia_: 3h5i A: [196576]
    automated match to d3f6pa_
    complexed with cl, na

Details for d3h5ia_

PDB Entry: 3h5i (more details), 1.9 Å

PDB Description: crystal structure of the n-terminal domain of a response regulator/sensory box/ggdef 3-domain protein from carboxydothermus hydrogenoformans
PDB Compounds: (A:) Response regulator/sensory box protein/GGDEF domain protein

SCOPe Domain Sequences for d3h5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5ia_ c.23.1.0 (A:) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]}
kkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmd
gvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrly
eanvh

SCOPe Domain Coordinates for d3h5ia_:

Click to download the PDB-style file with coordinates for d3h5ia_.
(The format of our PDB-style files is described here.)

Timeline for d3h5ia_: