Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Carboxydothermus hydrogenoformans [TaxId:246194] [196575] (1 PDB entry) |
Domain d3h5ia_: 3h5i A: [196576] automated match to d3f6pa_ complexed with cl, na |
PDB Entry: 3h5i (more details), 1.9 Å
SCOPe Domain Sequences for d3h5ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5ia_ c.23.1.0 (A:) automated matches {Carboxydothermus hydrogenoformans [TaxId: 246194]} kkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmd gvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrly eanvh
Timeline for d3h5ia_: