PDB entry 3h5i

View 3h5i on RCSB PDB site
Description: Crystal structure of the N-terminal domain of a response regulator/sensory box/GGDEF 3-domain protein from Carboxydothermus hydrogenoformans
Class: transcription
Keywords: STRUCTURAL GENOMICS, TRANSCRIPTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-04-22, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Response regulator/sensory box protein/GGDEF domain protein
  Species: Carboxydothermus hydrogenoformans Z-2901 [TaxId:246194]
  Gene: CHY_0880
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3ADQ4
  Domains in SCOPe 2.08: d3h5ia_
• Heterogens: NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3h5iA (A:)
  mslkdkkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdiel
  gegmdgvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivem
  alrlyeanvhaneghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3h5iA (A:)
  kkilivedskfqaktianilnkygytveialtgeaavekvsggwypdlilmdielgegmd
  gvqtalaiqqiselpvvfltahtepavvekirsvtaygyvmksateqvlitivemalrly
  eanvh