SCOPe 2.05: Domain d2wtlf_: 2wtl F:

Lineage for d2wtlf_ (2wtl F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (33 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)

8. Domain d2wtlf_: 2wtl F: [196492]
   automated match to d3bkna_
   complexed with fe, unl, unx

Details for d2wtlf_

PDB Entry: 2wtl, 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis

PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d2wtlf_:

Sequence; same for both SEQRES and ATOM records:

>d2wtlf_ a.25.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw

Timeline for d2wtlf_:

• d2wtlf_ first appeared in SCOPe 2.02
  
• d2wtlf_ appears in SCOPe 2.04
  
• d2wtlf_ is called d2wtlf1 in SCOPe 2.06
  
• d2wtlf_ appears in the current release, SCOPe 2.08, called d2wtlf1