SCOPe 2.05: Domain d2wtld_: 2wtl D:

Lineage for d2wtld_ (2wtl D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (33 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)

8. Domain d2wtld_: 2wtl D: [198549]
   automated match to d2wtlf_
   complexed with fe, unl, unx

Details for d2wtld_

PDB Entry: 2wtl, 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis

PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d2wtld_:

Sequence; same for both SEQRES and ATOM records:

>d2wtld_ a.25.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw

Timeline for d2wtld_:

• d2wtld_ first appeared in SCOPe 2.03
  
• d2wtld_ appears in SCOPe 2.04
  
• d2wtld_ is called d2wtld1 in SCOPe 2.06
  
• d2wtld_ appears in the current release, SCOPe 2.08, called d2wtld1