SCOPe 2.07: Domain d3cyra_: 3cyr A:

Lineage for d3cyra_ (3cyr A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
   Uniprot Q9L915

8. Domain d3cyra_: 3cyr A: [19648]
   complexed with hem

Details for d3cyra_

PDB Entry: 3cyr, 1.6 Å

PDB Description: cytochrome c3 from desulfovibrio desulfuricans atcc 27774p

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d3cyra_:

Sequence; same for both SEQRES and ATOM records:

>d3cyra_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpnkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhakgelkhtsclachskvvaekpelkkdltgcakskchp

Timeline for d3cyra_:

• d3cyra_ first appeared (with stable ids) in SCOP 1.55, called d3cyr__
  
• d3cyra_ appears in SCOPe 2.06
  
• d3cyra_ appears in the current release, SCOPe 2.08