PDB entry 3cyr

View 3cyr on RCSB PDB site
Description: cytochrome c3 from desulfovibrio desulfuricans atcc 27774p
Class: electron transport
Keywords: electron transport, cytochrome
Deposited on 1997-07-24, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio desulfuricans [TaxId:876]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9L915 (0-106)
    • conflict (5)
  Domains in SCOPe 2.07: d3cyra_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cyrA (A:)
  apavpnkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
  ekslyyvvhakgelkhtsclachskvvaekpelkkdltgcakskchp