Lineage for d3lmvf_ (3lmv F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528103Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2528104Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2528151Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2528152Protein automated matches [190596] (6 species)
    not a true protein
  7. 2528189Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries)
  8. 2528243Domain d3lmvf_: 3lmv F: [196468]
    automated match to d2dboa_
    protein/RNA complex; complexed with epe, so3

Details for d3lmvf_

PDB Entry: 3lmv (more details), 2.83 Å

PDB Description: d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes
PDB Compounds: (F:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d3lmvf_:

Sequence, based on SEQRES records: (download)

>d3lmvf_ c.110.1.0 (F:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthd

Sequence, based on observed residues (ATOM records): (download)

>d3lmvf_ c.110.1.0 (F:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwndknv
kdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynddkikigk
fgnymnidvtndgpvtiyidthd

SCOPe Domain Coordinates for d3lmvf_:

Click to download the PDB-style file with coordinates for d3lmvf_.
(The format of our PDB-style files is described here.)

Timeline for d3lmvf_: