Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (3 families) active form is a dimer |
Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
Protein automated matches [190596] (6 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [196467] (14 PDB entries) |
Domain d3lmvf_: 3lmv F: [196468] automated match to d2dboa_ protein/RNA complex; complexed with epe, so3 |
PDB Entry: 3lmv (more details), 2.83 Å
SCOPe Domain Sequences for d3lmvf_:
Sequence, based on SEQRES records: (download)
>d3lmvf_ c.110.1.0 (F:) automated matches {Plasmodium falciparum [TaxId: 36329]} mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii defkkqynddkikigkfgnymnidvtndgpvtiyidthd
>d3lmvf_ c.110.1.0 (F:) automated matches {Plasmodium falciparum [TaxId: 36329]} mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwndknv kdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynddkikigk fgnymnidvtndgpvtiyidthd
Timeline for d3lmvf_: