Lineage for d3ncba_ (3ncb A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486909Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1486985Protein automated matches [190263] (1 species)
    not a true protein
  7. 1486986Species Human (Homo sapiens) [TaxId:9606] [187052] (10 PDB entries)
  8. 1486991Domain d3ncba_: 3ncb A: [196420]
    Other proteins in same PDB: d3ncbb1, d3ncbb2
    automated match to d2q98a_
    complexed with cl, co3, na; mutant

Details for d3ncba_

PDB Entry: 3ncb (more details), 2.1 Å

PDB Description: a mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d3ncba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncba_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsakidnylkllkcri
ihnnnc

SCOPe Domain Coordinates for d3ncba_:

Click to download the PDB-style file with coordinates for d3ncba_.
(The format of our PDB-style files is described here.)

Timeline for d3ncba_: