Class a: All alpha proteins [46456] (171 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries) |
Domain d1a0rg_: 1a0r G: [19639] Other proteins in same PDB: d1a0rb_, d1a0rp_ complexed with ace, far |
PDB Entry: 1a0r (more details), 2.8 Å
SCOP Domain Sequences for d1a0rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0rg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} pviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedk npfke
Timeline for d1a0rg_: