| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
| Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
| Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
| Domain d1a0rg_: 1a0r G: [19639] Other proteins in same PDB: d1a0rb_, d1a0rp_ complexed with far |
PDB Entry: 1a0r (more details), 2.8 Å
SCOPe Domain Sequences for d1a0rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0rg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
pviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedk
npfke
Timeline for d1a0rg_: