Lineage for d1a0rg_ (1a0r G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [48673] (59 PDB entries)
  8. Domain d1a0rg_: 1a0r G: [19639]
    Other proteins in same PDB: d1a0rb_, d1a0rp_
    complexed with far

Details for d1a0rg_

PDB Entry: 1a0r (more details), 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma
PDB Compounds: (G:) transducin (gamma subunit)

SCOPe Domain Sequences for d1a0rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0rg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
pviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedk
npfke

SCOPe Domain Coordinates for d1a0rg_ are not available.

Timeline for d1a0rg_:

Domains from other chains:
(mouse over for more information)
d1a0rb_, d1a0rp_