Class a: All alpha proteins [46456] (151 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies) |
Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family) |
Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein) |
Protein Methanol dehydrogenase, light chain [48668] (2 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (2 PDB entries) |
Domain d4aahd_: 4aah D: [19626] Other proteins in same PDB: d4aaha_, d4aahc_ |
PDB Entry: 4aah (more details), 2.4 Å
SCOP Domain Sequences for d4aahd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aahd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks sgnfvfdvk
Timeline for d4aahd_: