Lineage for d4aahd_ (4aah D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733707Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2733708Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2733709Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 2733719Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)
  8. 2733731Domain d4aahd_: 4aah D: [19626]
    Other proteins in same PDB: d4aaha_, d4aahc_
    complexed with ca, pqq

Details for d4aahd_

PDB Entry: 4aah (more details), 2.4 Å

PDB Description: methanol dehydrogenase from methylophilus w3a1
PDB Compounds: (D:) methanol dehydrogenase

SCOPe Domain Sequences for d4aahd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aahd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

SCOPe Domain Coordinates for d4aahd_:

Click to download the PDB-style file with coordinates for d4aahd_.
(The format of our PDB-style files is described here.)

Timeline for d4aahd_: