Lineage for d2yc3a1 (2yc3 A:76-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2898987Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2899007Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142690] (12 PDB entries)
    Uniprot P69834 75-300
  8. 2899008Domain d2yc3a1: 2yc3 A:76-300 [196204]
    Other proteins in same PDB: d2yc3a2
    automated match to d1w77a1
    complexed with cd, cu, mw5, na

Details for d2yc3a1

PDB Entry: 2yc3 (more details), 1.4 Å

PDB Description: inhibitors of the herbicidal target ispd
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic

SCOPe Domain Sequences for d2yc3a1:

Sequence, based on SEQRES records: (download)

>d2yc3a1 c.68.1.13 (A:76-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrd
ifeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlk
dgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkse
glevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilse

Sequence, based on observed residues (ATOM records): (download)

>d2yc3a1 c.68.1.13 (A:76-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eksvsvillaggqgpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyee
sidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavga
avlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtdd
vsiveylkhpvyvsqgsytnikvttpddlllaerilse

SCOPe Domain Coordinates for d2yc3a1:

Click to download the PDB-style file with coordinates for d2yc3a1.
(The format of our PDB-style files is described here.)

Timeline for d2yc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yc3a2