PDB entry 2yc3

View 2yc3 on RCSB PDB site
Description: inhibitors of the herbicidal target ispd
Class: transferase
Keywords: transferase, non-mevalonate-pathway, herbicide, allosteric pocket
Deposited on 2011-03-11, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16454
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69834 (1-End)
      • expression tag (0)
      • conflict (74)
    Domains in SCOPe 2.07: d2yc3a1, d2yc3a2
  • Heterogens: MW5, NA, CU, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yc3A (A:)
    meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
    difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
    kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
    eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilseds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yc3A (A:)
    meksvsvillaggqgpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeye
    esidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavg
    aavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtd
    dvsiveylkhpvyvsqgsytnikvttpddlllaerilse