SCOP 1.73: Domain d1bega_: 1beg A:

Lineage for d1bega_ (1beg A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.134: Fungal elicitin [48646] (1 superfamily)
   5 helices: irregular disulfide-linked array; also contains a small beta-hairpin

4. Superfamily a.134.1: Fungal elicitin [48647] (1 family)

5. Family a.134.1.1: Fungal elicitin [48648] (2 proteins)

6. Protein beta-cryptogein [48649] (1 species)

7. Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)

8. Domain d1bega_: 1beg A: [19620]

Details for d1bega_

PDB Entry: 1beg

PDB Description: structure of fungal elicitor, nmr, 18 structures

PDB Compounds: (A:) beta-elicitin cryptogein

SCOP Domain Sequences for d1bega_:

Sequence; same for both SEQRES and ATOM records:

>d1bega_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

Timeline for d1bega_:

• d1bega_ first appeared (with stable ids) in SCOP 1.55, called d1beg__
  
• d1bega_ was called d1beg__ in SCOP 1.71
  
• d1bega_ appears in SCOP 1.75
  
• d1bega_ appears in the current release, SCOPe 2.08