![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.134: Fungal elicitin [48646] (1 superfamily) 5 helices: irregular disulfide-linked array; also contains a small beta-hairpin |
![]() | Superfamily a.134.1: Fungal elicitin [48647] (1 family) ![]() automatically mapped to Pfam PF00964 |
![]() | Family a.134.1.1: Fungal elicitin [48648] (2 proteins) |
![]() | Protein beta-cryptogein [48649] (1 species) |
![]() | Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries) |
![]() | Domain d1bega_: 1beg A: [19620] |
PDB Entry: 1beg (more details)
SCOPe Domain Sequences for d1bega_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bega_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]} tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi kkivtlnppncdltvptsglvlnvysyangfsnkcssl
Timeline for d1bega_: