PDB entry 1beg

View 1beg on RCSB PDB site
Description: structure of fungal elicitor, nmr, 18 structures
Class: signal
Keywords: signal, fungal elicitor, signalling protein, fungal toxin
Deposited on 1996-11-26, released 1997-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-elicitin cryptogein
  Species: Phytophthora cryptogea [TaxId:4786]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15570 (0-97)
  Domains in SCOPe 2.08: d1bega_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1begA (A:)
  tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
  kkivtlnppncdltvptsglvlnvysyangfsnkcssl