SCOP 1.71: Domain d1beg__: 1beg -

Lineage for d1beg__ (1beg -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.134: Fungal elicitin [48646] (1 superfamily)
   5 helices: irregular disulfide-linked array; also contains a small beta-hairpin

4. Superfamily a.134.1: Fungal elicitin [48647] (1 family)

5. Family a.134.1.1: Fungal elicitin [48648] (2 proteins)

6. Protein beta-cryptogein [48649] (1 species)

7. Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)

8. Domain d1beg__: 1beg - [19620]

Details for d1beg__

PDB Entry: 1beg

PDB Description: structure of fungal elicitor, nmr, 18 structures

SCOP Domain Sequences for d1beg__:

Sequence; same for both SEQRES and ATOM records:

>d1beg__ a.134.1.1 (-) beta-cryptogein {Phytophthora cryptogea}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

Timeline for d1beg__:

• d1beg__ first appeared (with stable ids) in SCOP 1.55
  
• d1beg__ appears in SCOP 1.69
  
• d1beg__ is called d1bega_ in SCOP 1.73
  
• d1beg__ appears in the current release, SCOPe 2.08, called d1bega_