Class a: All alpha proteins [46456] (289 folds) |
Fold a.134: Fungal elicitin [48646] (1 superfamily) 5 helices: irregular disulfide-linked array; also contains a small beta-hairpin |
Superfamily a.134.1: Fungal elicitin [48647] (1 family) automatically mapped to Pfam PF00964 |
Family a.134.1.1: Fungal elicitin [48648] (2 proteins) |
Protein beta-cryptogein [48649] (1 species) |
Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries) |
Domain d1bxma_: 1bxm A: [19618] engineered beta-cryptogein complexed with ergosterol complexed with erg |
PDB Entry: 1bxm (more details), 2.15 Å
SCOPe Domain Sequences for d1bxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxma_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]} rgtctatqqtaayhtlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntm ikkivtlnppncdltvptsglvlnvysyangfsnkcssl
Timeline for d1bxma_: