Lineage for d1bxma_ (1bxm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346593Fold a.134: Fungal elicitin [48646] (1 superfamily)
    5 helices: irregular disulfide-linked array; also contains a small beta-hairpin
  4. 2346594Superfamily a.134.1: Fungal elicitin [48647] (1 family) (S)
    automatically mapped to Pfam PF00964
  5. 2346595Family a.134.1.1: Fungal elicitin [48648] (2 proteins)
  6. 2346604Protein beta-cryptogein [48649] (1 species)
  7. 2346605Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)
  8. 2346607Domain d1bxma_: 1bxm A: [19618]
    engineered beta-cryptogein complexed with ergosterol
    complexed with erg

Details for d1bxma_

PDB Entry: 1bxm (more details), 2.15 Å

PDB Description: engineered beta-cryptogein complexed with ergosterol
PDB Compounds: (A:) beta-cryptogein

SCOPe Domain Sequences for d1bxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxma_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]}
rgtctatqqtaayhtlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntm
ikkivtlnppncdltvptsglvlnvysyangfsnkcssl

SCOPe Domain Coordinates for d1bxma_:

Click to download the PDB-style file with coordinates for d1bxma_.
(The format of our PDB-style files is described here.)

Timeline for d1bxma_: