Lineage for d1bxm__ (1bxm -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.134: Fungal elicitin, plant patogen [48646] (1 superfamily) Superfamily a.134.1: Fungal elicitin, plant patogen [48647] (1 family) 
Family a.134.1.1: Fungal elicitin, plant patogen [48648] (1 protein) Protein beta-cryptogein [48649] (1 species) Species Phytophthora cryptogea [TaxId:4786] [48650] (3 PDB entries) 
Domain d1bxm__: 1bxm - [19618]
Details for d1bxm__
PDB Entry: 1bxm (more details), 2.15 Å
PDB Description: engineered beta-cryptogein complexed with ergosterol
SCOP Domain Sequences for d1bxm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxm__ a.134.1.1 (-) beta-cryptogein {Phytophthora cryptogea}
rgtctatqqtaayhtlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntm
ikkivtlnppncdltvptsglvlnvysyangfsnkcssl
SCOP Domain Coordinates for d1bxm__:
Click to download the PDB-style file with coordinates for d1bxm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxm__:
- d1bxm__ appears in SCOP 1.57
- d1bxm__ appears in the current release, SCOPe 2.08, called d1bxma_
View in 3D