SCOPe 2.07: Domain d3q37d_: 3q37 D:

Lineage for d3q37d_ (3q37 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein automated matches [196175] (9 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196176] (1 PDB entry)

8. Domain d3q37d_: 3q37 D: [196177]
   automated match to d1suxa_

Details for d3q37d_

PDB Entry: 3q37, 1.65 Å

PDB Description: identification of amino acids that account for long-range interactions in proteins using two triosephosphate isomerases from pathogenic trypanosomes.

PDB Compounds: (D:) TIM from Trypanosoma cruzi/ TIM from Trypanosoma brucei brucei chimera protein

SCOPe Domain Sequences for d3q37d_:

Sequence; same for both SEQRES and ATOM records:

>d3q37d_ c.1.1.1 (D:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvaptflhipmtkarltnpkfq
iaaqnaitrsgaftgevslqilkdygiswvvlghserrayygetneivadkvaaavasgf
hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
fveiieat

Timeline for d3q37d_:

• d3q37d_ first appeared in SCOPe 2.02
  
• d3q37d_ appears in SCOPe 2.06
  
• d3q37d_ appears in the current release, SCOPe 2.08