SCOPe 2.04: Domain d3tqza_: 3tqz A:

Lineage for d3tqza_ (3tqz A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [196147] (1 PDB entry)

8. Domain d3tqza_: 3tqz A: [196148]
   automated match to d1rn8a_
   complexed with so4

Details for d3tqza_

PDB Entry: 3tqz, 1.75 Å

PDB Description: structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3tqza_:

Sequence; same for both SEQRES and ATOM records:

>d3tqza_ b.85.4.1 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
mthsvqlkildkrlgsefplpayattgsagldlracldeplkiepdetclistglaiylg
hsnvaatilprsglghkhgivlgnlvglidsdyqgplmvscwnrgkepytinpgdriaql
vvlpilkaqfavveefel

Timeline for d3tqza_:

• d3tqza_ first appeared in SCOPe 2.02
  
• d3tqza_ appears in SCOPe 2.03
  
• d3tqza_ appears in SCOPe 2.05
  
• d3tqza_ appears in the current release, SCOPe 2.08