Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (4 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [196147] (1 PDB entry) |
Domain d3tqza_: 3tqz A: [196148] automated match to d1rn8a_ complexed with so4 |
PDB Entry: 3tqz (more details), 1.75 Å
SCOPe Domain Sequences for d3tqza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqza_ b.85.4.1 (A:) automated matches {Coxiella burnetii [TaxId: 777]} mthsvqlkildkrlgsefplpayattgsagldlracldeplkiepdetclistglaiylg hsnvaatilprsglghkhgivlgnlvglidsdyqgplmvscwnrgkepytinpgdriaql vvlpilkaqfavveefel
Timeline for d3tqza_: