Lineage for d3tqza_ (3tqz A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139748Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1139893Protein automated matches [190798] (4 species)
    not a true protein
  7. 1139896Species Coxiella burnetii [TaxId:777] [196147] (1 PDB entry)
  8. 1139897Domain d3tqza_: 3tqz A: [196148]
    automated match to d1rn8a_
    complexed with so4

Details for d3tqza_

PDB Entry: 3tqz (more details), 1.75 Å

PDB Description: structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3tqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqza_ b.85.4.1 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
mthsvqlkildkrlgsefplpayattgsagldlracldeplkiepdetclistglaiylg
hsnvaatilprsglghkhgivlgnlvglidsdyqgplmvscwnrgkepytinpgdriaql
vvlpilkaqfavveefel

SCOPe Domain Coordinates for d3tqza_:

Click to download the PDB-style file with coordinates for d3tqza_.
(The format of our PDB-style files is described here.)

Timeline for d3tqza_: