Lineage for d3zvyb_ (3zvy B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2589001Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 2589002Protein automated matches [190772] (5 species)
    not a true protein
  7. 2589007Species Human (Homo sapiens) [TaxId:9606] [187998] (25 PDB entries)
  8. 2589014Domain d3zvyb_: 3zvy B: [196094]
    automated match to d3zvzb_
    complexed with cl, trs, zn

Details for d3zvyb_

PDB Entry: 3zvy (more details), 1.95 Å

PDB Description: phd finger of human uhrf1 in complex with unmodified histone h3 n- terminal tail
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3zvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvyb_ g.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedewy
cpecrn

SCOPe Domain Coordinates for d3zvyb_:

Click to download the PDB-style file with coordinates for d3zvyb_.
(The format of our PDB-style files is described here.)

Timeline for d3zvyb_: