Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
Protein automated matches [190772] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
Domain d3zvyb_: 3zvy B: [196094] automated match to d3zvzb_ complexed with cl, trs, zn |
PDB Entry: 3zvy (more details), 1.95 Å
SCOPe Domain Sequences for d3zvyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvyb_ g.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} psckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedewy cpecrn
Timeline for d3zvyb_: