PDB entry 3zvy

View 3zvy on RCSB PDB site
Description: PHD finger of human UHRF1 in complex with unmodified histone H3 N- terminal tail
Class: ligase/peptide
Keywords: ligase-peptide complex, histone reader, epigenetics
Deposited on 2011-07-28, released 2011-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zvyb_
  • Chain 'C':
    Compound: Histone H3.1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone H3.1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, TRS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zvyB (B:)
    rksgpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpse
    dewycpecrnda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zvyB (B:)
    psckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedewy
    cpecrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.