Lineage for d3ejfa_ (3ejf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489006Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2489007Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2489711Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2489712Protein automated matches [190146] (12 species)
    not a true protein
  7. 2489713Species Avian infectious bronchitis virus (strain beaudette) [TaxId:11120] [196077] (2 PDB entries)
  8. 2489714Domain d3ejfa_: 3ejf A: [196078]
    automated match to d2vria_

Details for d3ejfa_

PDB Entry: 3ejf (more details), 1.6 Å

PDB Description: crystal structure of ibv x-domain at ph 8.5
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3ejfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejfa_ c.50.1.0 (A:) automated matches {Avian infectious bronchitis virus (strain beaudette) [TaxId: 11120]}
kpkfleyktcvgdltvviakaldefkefcivnaanehmthgsgvakaiadfcgldfveyc
edyvkkhgpqqrlvtpsfvkgiqcvnnvvgprhgdnnlheklvaayknvlvdgvvnyvvp
vlslgifgvdfkmsidamreafegctirvllfslsqehidyfdvtc

SCOPe Domain Coordinates for d3ejfa_:

Click to download the PDB-style file with coordinates for d3ejfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ejfa_: