Lineage for d4dgac_ (4dga C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003180Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2003181Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2003182Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2003221Protein HIV-1 capsid protein [47945] (1 species)
  7. 2003222Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2003248Domain d4dgac_: 4dga C: [196071]
    Other proteins in same PDB: d4dgaa_, d4dgab_
    automated match to d1m9dc_

Details for d4dgac_

PDB Entry: 4dga (more details), 1.9 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: HIV-1 CA(O-loop) complex
PDB Compounds: (C:) capsid protein

SCOPe Domain Sequences for d4dgac_:

Sequence, based on SEQRES records: (download)

>d4dgac_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Sequence, based on observed residues (ATOM records): (download)

>d4dgac_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamq
mlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmthnppipvg
eiykrwiilglnkivrmy

SCOPe Domain Coordinates for d4dgac_:

Click to download the PDB-style file with coordinates for d4dgac_.
(The format of our PDB-style files is described here.)

Timeline for d4dgac_: