Lineage for d3p2pa_ (3p2p A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505317Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1505318Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1505323Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1505324Protein Phospholipase A2 [48637] (5 species)
  7. 1505400Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (21 PDB entries)
  8. 1505419Domain d3p2pa_: 3p2p A: [19607]
    complexed with ca

Details for d3p2pa_

PDB Entry: 3p2p (more details), 2.1 Å

PDB Description: enhanced activity and altered specificity of phospholipase a2 by deletion of a surface loop
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d3p2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2pa_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc

SCOPe Domain Coordinates for d3p2pa_:

Click to download the PDB-style file with coordinates for d3p2pa_.
(The format of our PDB-style files is described here.)

Timeline for d3p2pa_: